SCOPe 2.03: Domain d3pqfd2: 3pqf D:148-314

Lineage for d3pqfd2 (3pqf D:148-314)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (21 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)

8. Domain d3pqfd2: 3pqf D:148-314 [214932]
   Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1
   automated match to d1llca2
   complexed with nad; mutant

Details for d3pqfd2

PDB Entry: 3pqf, 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfd2:

Sequence; same for both SEQRES and ATOM records:

>d3pqfd2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

Timeline for d3pqfd2:

• d3pqfd2 is new in SCOPe 2.03-stable
  
• d3pqfd2 appears in SCOPe 2.04
  
• d3pqfd2 appears in the current release, SCOPe 2.08