Lineage for d3pqfb2 (3pqf B:148-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999558Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)
  8. 2999560Domain d3pqfb2: 3pqf B:148-315 [214928]
    Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1
    automated match to d1llca2
    complexed with nad; mutant

Details for d3pqfb2

PDB Entry: 3pqf (more details), 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqfb2 d.162.1.0 (B:148-315) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphfa

SCOPe Domain Coordinates for d3pqfb2:

Click to download the PDB-style file with coordinates for d3pqfb2.
(The format of our PDB-style files is described here.)

Timeline for d3pqfb2: