SCOPe 2.08: Domain d3pqfb2: 3pqf B:148-315

Lineage for d3pqfb2 (3pqf B:148-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)

8. Domain d3pqfb2: 3pqf B:148-315 [214928]
   Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1
   automated match to d1llca2
   complexed with nad; mutant

Details for d3pqfb2

PDB Entry: 3pqf, 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfb2:

Sequence; same for both SEQRES and ATOM records:

>d3pqfb2 d.162.1.0 (B:148-315) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphfa

Timeline for d3pqfb2:

• d3pqfb2 first appeared in SCOPe 2.03
  
• d3pqfb2 appears in SCOPe 2.07