PDB entry 3pqf

View 3pqf on RCSB PDB site
Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+
Class: oxidoreductase
Keywords: L-lactate dehydrogenase, FBP, NAD+, OXIDOREDUCTASE
Deposited on 2010-11-26, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.06: d3pqfa1, d3pqfa2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.06: d3pqfb1, d3pqfb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.06: d3pqfc1, d3pqfc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.06: d3pqfd1, d3pqfd2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqfA (A:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqfA (A:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
    tnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdt
    elpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsla
    ritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflh
    sagvlknilkphfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pqfB (B:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqfB (B:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
    tnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdt
    elpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsla
    ritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflh
    sagvlknilkphfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pqfC (C:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqfC (C:)
    khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk
    tsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvat
    npvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdte
    lpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslar
    itkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhs
    agvlknilkphf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pqfD (D:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqfD (D:)
    khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk
    tsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvat
    npvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdte
    lpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamslar
    itkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhs
    agvlknilkphf