Lineage for d3pkzk_ (3pkz K:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857122Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 1857146Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 1857147Protein automated matches [226976] (3 species)
    not a true protein
  7. 1857151Species Staphylococcus aureus [TaxId:1280] [226158] (1 PDB entry)
  8. 1857162Domain d3pkzk_: 3pkz K: [214848]
    automated match to d2rslc_
    complexed with edo, gol, so4

Details for d3pkzk_

PDB Entry: 3pkz (more details), 1.8 Å

PDB Description: Structural basis for catalytic activation of a serine recombinase
PDB Compounds: (K:) Recombinase Sin

SCOPe Domain Sequences for d3pkzk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pkzk_ c.53.1.0 (K:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdliirilamv
seqe

SCOPe Domain Coordinates for d3pkzk_:

Click to download the PDB-style file with coordinates for d3pkzk_.
(The format of our PDB-style files is described here.)

Timeline for d3pkzk_: