Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.1: Resolvase-like [53041] (2 families) automatically mapped to Pfam PF00239 |
Family c.53.1.0: automated matches [227230] (1 protein) not a true family |
Protein automated matches [226976] (3 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries) |
Domain d3pkzj_: 3pkz J: [214847] automated match to d2rslc_ complexed with edo, gol, so4 |
PDB Entry: 3pkz (more details), 1.8 Å
SCOPe Domain Sequences for d3pkzj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pkzj_ c.53.1.0 (J:) automated matches {Staphylococcus aureus [TaxId: 1280]} miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdliirilamv seqe
Timeline for d3pkzj_: