Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries) |
Domain d1mcdb2: 1mcd B:112-216 [21479] Other proteins in same PDB: d1mcda1, d1mcdb1 |
PDB Entry: 1mcd (more details), 2.7 Å
SCOP Domain Sequences for d1mcdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcdb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcdb2: