SCOPe 2.05: Domain d3paga_: 3pag A:

Lineage for d3paga_ (3pag A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (31 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries)

8. Domain d3paga_: 3pag A: [214734]
   automated match to d1k38a_
   complexed with drw, so4; mutant

Details for d3paga_

PDB Entry: 3pag, 2.25 Å

PDB Description: crystal structure of the v130d mutant of oxa-24/40 in complex with doripenem

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3paga_:

Sequence; same for both SEQRES and ATOM records:

>d3paga_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
mhissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnali
glenhkattneifkwdgkkrtypmwekdmtlgeamalsadpvyqelarrtglelmqkevk
rvnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikev
ngskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneityksle
nlgii

Timeline for d3paga_:

• d3paga_ first appeared in SCOPe 2.03
  
• d3paga_ appears in SCOPe 2.04
  
• d3paga_ appears in SCOPe 2.06
  
• d3paga_ appears in the current release, SCOPe 2.08