SCOP 1.67: Domain d1mcoh4: 1mco H:328-428

Lineage for d1mcoh4 (1mco H:328-428)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (20 PDB entries)

8. Domain d1mcoh4: 1mco H:328-428 [21471]
   Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcol1, d1mcol2
   part of intact antibody MCG
   complexed with fuc, gal, man, nag, sia

Details for d1mcoh4

PDB Entry: 1mco, 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

SCOP Domain Sequences for d1mcoh4:

Sequence; same for both SEQRES and ATOM records:

>d1mcoh4 b.1.1.2 (H:328-428) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1mcoh4:

• d1mcoh4 first appeared (with stable ids) in SCOP 1.55
  
• d1mcoh4 appears in SCOP 1.65
  
• d1mcoh4 appears in SCOP 1.69
  
• d1mcoh4 appears in the current release, SCOPe 2.08