SCOPe 2.04: Domain d3p98b_: 3p98 B:

Lineage for d3p98b_ (3p98 B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Morganella morganii [TaxId:582] [226088] (1 PDB entry)

8. Domain d3p98b_: 3p98 B: [214709]
   automated match to d1jtda_
   complexed with cit, peg

Details for d3p98b_

PDB Entry: 3p98, 2.1 Å

PDB Description: The crystal structure of the extended spectrum beta-lactamase TEM-72 reveals inhibition by citrate

PDB Compounds: (B:) Beta-lactamase TEM-72

SCOPe Domain Sequences for d3p98b_:

Sequence; same for both SEQRES and ATOM records:

>d3p98b_ e.3.1.1 (B:) automated matches {Morganella morganii [TaxId: 582]}
hpetlvkvkdaedklgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgaskrgsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d3p98b_:

• d3p98b_ first appeared in SCOPe 2.03
  
• d3p98b_ appears in SCOPe 2.05
  
• d3p98b_ appears in the current release, SCOPe 2.08