Lineage for d3p98b_ (3p98 B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1691044Species Morganella morganii [TaxId:582] [226088] (1 PDB entry)
  8. 1691046Domain d3p98b_: 3p98 B: [214709]
    automated match to d1jtda_
    complexed with cit, peg

Details for d3p98b_

PDB Entry: 3p98 (more details), 2.1 Å

PDB Description: The crystal structure of the extended spectrum beta-lactamase TEM-72 reveals inhibition by citrate
PDB Compounds: (B:) Beta-lactamase TEM-72

SCOPe Domain Sequences for d3p98b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p98b_ e.3.1.1 (B:) automated matches {Morganella morganii [TaxId: 582]}
hpetlvkvkdaedklgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgaskrgsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3p98b_:

Click to download the PDB-style file with coordinates for d3p98b_.
(The format of our PDB-style files is described here.)

Timeline for d3p98b_: