SCOPe 2.08: Domain d3p98a_: 3p98 A:

Lineage for d3p98a_ (3p98 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Morganella morganii [TaxId:582] [226088] (1 PDB entry)

8. Domain d3p98a_: 3p98 A: [214708]
   automated match to d1jtda_
   complexed with cit, peg

Details for d3p98a_

PDB Entry: 3p98, 2.1 Å

PDB Description: The crystal structure of the extended spectrum beta-lactamase TEM-72 reveals inhibition by citrate

PDB Compounds: (A:) Beta-lactamase TEM-72

SCOPe Domain Sequences for d3p98a_:

Sequence; same for both SEQRES and ATOM records:

>d3p98a_ e.3.1.1 (A:) automated matches {Morganella morganii [TaxId: 582]}
hpetlvkvkdaedklgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgaskrgsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d3p98a_:

• d3p98a_ first appeared in SCOPe 2.03
  
• d3p98a_ appears in SCOPe 2.07