Lineage for d4bjlb2 (4bjl B:112-216)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454411Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 454415Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 454446Domain d4bjlb2: 4bjl B:112-216 [21465]
    Other proteins in same PDB: d4bjla1, d4bjlb1
    part of Bence-Jones protein LOC

Details for d4bjlb2

PDB Entry: 4bjl (more details), 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjlb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d4bjlb2:

Click to download the PDB-style file with coordinates for d4bjlb2.
(The format of our PDB-style files is described here.)

Timeline for d4bjlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bjlb1