| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (45 species) not a true protein |
| Species Toxoplasma gondii [TaxId:508771] [225975] (1 PDB entry) |
| Domain d3otrb2: 3otr B:148-447 [214544] Other proteins in same PDB: d3otra1, d3otrb1, d3otrc1, d3otrd1, d3otre1, d3otrf1 automated match to d1pdza1 complexed with cl, so4 |
PDB Entry: 3otr (more details), 2.75 Å
SCOPe Domain Sequences for d3otrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otrb2 c.1.11.0 (B:148-447) automated matches {Toxoplasma gondii [TaxId: 508771]}
dkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky
gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkyd
ldykcktknaskhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqv
igddilvtnilriekalkdkacnclllkvnqigsvteaieacllaqksgwgvqvshrsge
tedsfiadlvvglrcgqiksgspcrserlckynqlmrieeslgadcvyagesfrhpkrsh
Timeline for d3otrb2: