PDB entry 3otr

View 3otr on RCSB PDB site
Description: 2.75 Angstrom Crystal Structure of Enolase 1 from Toxoplasma gondii
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Alpha-Beta Barrel, TIM Barrel, Enolase 1 like N-terminal domain, 2-phospho-D-glycerate hydrolase, LYASE
Deposited on 2010-09-13, released 2010-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.173
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3otra1, d3otra2
  • Chain 'B':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6KCK6 (0-443)
      • expression tag (444-446)
    Domains in SCOPe 2.03: d3otrb1, d3otrb2
  • Chain 'C':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6KCK6 (0-443)
      • expression tag (444-447)
    Domains in SCOPe 2.03: d3otrc1, d3otrc2
  • Chain 'D':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6KCK6 (0-443)
      • expression tag (444-445)
    Domains in SCOPe 2.03: d3otrd1, d3otrd2
  • Chain 'E':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6KCK6 (0-443)
      • expression tag (444-448)
    Domains in SCOPe 2.03: d3otre1, d3otre2
  • Chain 'F':
    Compound: enolase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_068860
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6KCK6 (0-443)
      • expression tag (444-445)
    Domains in SCOPe 2.03: d3otrf1, d3otrf2
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3otrA (A:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrA (A:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3otrB (B:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrB (B:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrsh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3otrC (C:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrC (C:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcaskhltgeklkevyegwlkkypiisved
    pfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqigsvte
    aieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckynqlmr
    ieeslgadcvyagesfrhpkrshh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3otrD (D:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrD (D:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykckhltgeklkevyegwlkkypiisvedpf
    dqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqigsvteai
    eacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckynqlmrie
    eslgadcvyagesfrhpkrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3otrE (E:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrE (E:)
    mvvikdivareildsrgnptievdvsteggvfraavpsggiyealelrdkdpkrylgkgv
    lnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvsiac
    cragaaskglplykyiatlagkdkmvmpvpffnvinggehagnglalqefliapvgapni
    reairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaikaagyeg
    kikiafdaaasefykqdekkydldykcaskhltgeklkevyegwlkkypiisvedpfdqd
    dfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqigsvteaieac
    llaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckynqlmrieesl
    gadcvyagesfrhpkrshhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3otrF (F:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagktidkmvmpvpffnvinggehagnglalqefliapv
    gapnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaika
    agyegkikiafdaaasefykqdekkydldykcktknaskhltgeklkevyegwlkkypii
    svedpfdqddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqig
    svteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckyn
    qlmrieeslgadcvyagesfrhpkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otrF (F:)
    mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
    kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
    iaccragaaskglplykyiatlagkdkmvmpvpffnvinggehagnglalqefliapvga
    pnireairygsetyhhlknviknkygldatnvgdeggfapnvataeealnllveaikaag
    yegkikiafdaaasefykqdekkydldykcskhltgeklkevyegwlkkypiisvedpfd
    qddfasfsaftkdvgektqvigddilvtnilriekalkdkacnclllkvnqigsvteaie
    acllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrserlckynqlmriee
    slgadcvyagesfrhpkrs