SCOPe 2.08: Domain d3opma2: 3opm A:509-766

Lineage for d3opma2 (3opm A:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)

8. Domain d3opma2: 3opm A:509-766 [214465]
   Other proteins in same PDB: d3opma1, d3opmb1, d3opmb3, d3opmc1, d3opmd1
   automated match to d1orva2
   complexed with lui, nag

Details for d3opma2

PDB Entry: 3opm, 2.72 Å

PDB Description: crystal structure of human dpp4 bound to tak-294

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3opma2:

Sequence; same for both SEQRES and ATOM records:

>d3opma2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d3opma2:

• d3opma2 first appeared in SCOPe 2.03
  
• d3opma2 appears in SCOPe 2.07