Lineage for d3ojva_ (3ojv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401199Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2401213Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2401404Domain d3ojva_: 3ojv A: [214399]
    Other proteins in same PDB: d3ojvc1, d3ojvc2, d3ojvd1, d3ojvd2
    automated match to d1barb_

Details for d3ojva_

PDB Entry: 3ojv (more details), 2.6 Å

PDB Description: crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3ojva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojva_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
gqkailflplpvs

SCOPe Domain Coordinates for d3ojva_:

Click to download the PDB-style file with coordinates for d3ojva_.
(The format of our PDB-style files is described here.)

Timeline for d3ojva_: