Lineage for d3oa9a_ (3oa9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242214Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 2242215Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 2242216Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 2242221Protein automated matches [190936] (6 species)
    not a true protein
  7. 2242232Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries)
  8. 2242250Domain d3oa9a_: 3oa9 A: [214268]
    automated match to d3kwgb_

Details for d3oa9a_

PDB Entry: 3oa9 (more details), 2.9 Å

PDB Description: Effector domain of influenza A/Duck/Albany/76 NS1
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d3oa9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oa9a_ d.299.1.1 (A:) automated matches {Influenza A virus [TaxId: 381517]}
yitdmsieeisrewymlmprqkitgglmvkmdqaimdkritlkanfsvlfdqletlvslr
aftddgaivaeispipsmpghstedvknaigiligglewndnsiraseniqrfa

SCOPe Domain Coordinates for d3oa9a_:

Click to download the PDB-style file with coordinates for d3oa9a_.
(The format of our PDB-style files is described here.)

Timeline for d3oa9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3oa9b_