SCOPe 2.07: Domain d3oa4a1: 3oa4 A:5-139

Lineage for d3oa4a1 (3oa4 A:5-139)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [225948] (1 PDB entry)

8. Domain d3oa4a1: 3oa4 A:5-139 [214267]
   Other proteins in same PDB: d3oa4a2
   automated match to d1jc5b_
   complexed with gol, so4, zn

Details for d3oa4a1

PDB Entry: 3oa4, 1.94 Å

PDB Description: crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125

PDB Compounds: (A:) glyoxalase

SCOPe Domain Sequences for d3oa4a1:

Sequence; same for both SEQRES and ATOM records:

>d3oa4a1 d.32.1.0 (A:5-139) automated matches {Bacillus halodurans [TaxId: 272558]}
ksnkldhigiavtsikdvlpfyvgslklkllgmedlpsqgvkiafleigeskiellepls
eespiakfiqkrgegihhiaigvksieeriqevkengvqmindepvpgargaqvaflhpr
sargvlyefcekkeq

Timeline for d3oa4a1:

• d3oa4a1 first appeared in SCOPe 2.03, called d3oa4a_
  
• d3oa4a1 appears in SCOPe 2.06
  
• d3oa4a1 appears in the current release, SCOPe 2.08