SCOPe 2.06: Domain d3o9tb_: 3o9t B:

Lineage for d3o9tb_ (3o9t B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (6 species)
   not a true protein

7. Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries)

8. Domain d3o9tb_: 3o9t B: [214258]
   automated match to d3kwgb_
   complexed with p6g

Details for d3o9tb_

PDB Entry: 3o9t, 2.2 Å

PDB Description: Effector domain from influenza A/PR/8/34 NS1

PDB Compounds: (B:) nonstructural protein 1

SCOPe Domain Sequences for d3o9tb_:

Sequence; same for both SEQRES and ATOM records:

>d3o9tb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]}
svpasryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrle
tlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfa
w

Timeline for d3o9tb_:

• d3o9tb_ first appeared in SCOPe 2.03
  
• d3o9tb_ appears in SCOPe 2.05
  
• d3o9tb_ appears in SCOPe 2.07
  
• d3o9tb_ appears in the current release, SCOPe 2.08