![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
![]() | Domain d1f3dl2: 1f3d L:108-213 [21424] Other proteins in same PDB: d1f3dh1, d1f3dh2, d1f3dj1, d1f3dk1, d1f3dk2, d1f3dl1 |
PDB Entry: 1f3d (more details), 1.87 Å
SCOP Domain Sequences for d1f3dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3dl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrna
Timeline for d1f3dl2: