SCOP 1.65: Domain d1f3dh1: 1f3d H:1-121

Lineage for d1f3dh1 (1f3d H:1-121)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
Domain d1f3dh1: 1f3d H:1-121 [20462]
Other proteins in same PDB: d1f3dh2, d1f3dj1, d1f3dj2, d1f3dk2, d1f3dl1, d1f3dl2

Details for d1f3dh1

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvss

SCOP Domain Coordinates for d1f3dh1:

Click to download the PDB-style file with coordinates for d1f3dh1.
(The format of our PDB-style files is described here.)

Timeline for d1f3dh1: