SCOPe 2.07: Domain d3o5ib1: 3o5i B:16-140

Lineage for d3o5ib1 (3o5i B:16-140)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries)

8. Domain d3o5ib1: 3o5i B:16-140 [214184]
   Other proteins in same PDB: d3o5ia2, d3o5ib2
   automated match to d4drja_
   complexed with act, gol

Details for d3o5ib1

PDB Entry: 3o5i, 1.8 Å

PDB Description: Fk1 domain of FKBP51, crystal form II

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d3o5ib1:

Sequence; same for both SEQRES and ATOM records:

>d3o5ib1 d.26.1.1 (B:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

Timeline for d3o5ib1:

• d3o5ib1 first appeared in SCOPe 2.03, called d3o5ib_
  
• d3o5ib1 appears in SCOPe 2.06
  
• d3o5ib1 appears in the current release, SCOPe 2.08