SCOPe 2.08: Domain d3o4gb1: 3o4g B:7-321

Lineage for d3o4gb1 (3o4g B:7-321)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)

6. Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
   Uniprot Q9YBQ2

8. Domain d3o4gb1: 3o4g B:7-321 [214151]
   Other proteins in same PDB: d3o4ga2, d3o4gb2, d3o4gc2, d3o4gd2
   automated match to d1ve6a1
   complexed with gol

Details for d3o4gb1

PDB Entry: 3o4g, 2.5 Å

PDB Description: Structure and Catalysis of Acylaminoacyl Peptidase

PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d3o4gb1:

Sequence; same for both SEQRES and ATOM records:

>d3o4gb1 b.69.7.2 (B:7-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
vefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepins
vldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvf
tgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgg
lrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrpt
aitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstpp
rivslpsgepllegg

Timeline for d3o4gb1:

• d3o4gb1 first appeared in SCOPe 2.03
  
• d3o4gb1 appears in SCOPe 2.07