Lineage for d3o4gd1 (3o4g D:6-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809416Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2809457Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 2809458Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 2809459Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2809473Domain d3o4gd1: 3o4g D:6-321 [214155]
    Other proteins in same PDB: d3o4ga2, d3o4gb2, d3o4gc2, d3o4gd2
    automated match to d1ve6a1
    complexed with gol

Details for d3o4gd1

PDB Entry: 3o4g (more details), 2.5 Å

PDB Description: Structure and Catalysis of Acylaminoacyl Peptidase
PDB Compounds: (D:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d3o4gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4gd1 b.69.7.2 (D:6-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
pvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepin
svldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavv
ftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssg
glrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrp
taitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstp
privslpsgepllegg

SCOPe Domain Coordinates for d3o4gd1:

Click to download the PDB-style file with coordinates for d3o4gd1.
(The format of our PDB-style files is described here.)

Timeline for d3o4gd1: