SCOP 1.69: Domain d1deef2: 1dee F:2622-2723

Lineage for d1deef2 (1dee F:2622-2723)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)

8. Domain d1deef2: 1dee F:2622-2723 [21413]
   Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deec1, d1deec2, d1deed1, d1deee1, d1deee2, d1deef1, d1deeg_, d1deeh_
   part of IgM rheumatoid factor Fab

Details for d1deef2

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deef2:

Sequence; same for both SEQRES and ATOM records:

>d1deef2 b.1.1.2 (F:2622-2723) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

Timeline for d1deef2:

• d1deef2 first appeared (with stable ids) in SCOP 1.55
  
• d1deef2 appears in SCOP 1.67
  
• d1deef2 appears in SCOP 1.71
  
• d1deef2 appears in the current release, SCOPe 2.08