Lineage for d3o2vl2 (3o2v L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759807Domain d3o2vl2: 3o2v L:108-213 [214129]
    Other proteins in same PDB: d3o2vl1
    automated match to d1t66c2
    complexed with flc, so4, trs

Details for d3o2vl2

PDB Entry: 3o2v (more details), 2.3 Å

PDB Description: Crystal structure of 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe, an engineered Diels-Alderase Fab with modified specificity and catalytic activity
PDB Compounds: (L:) Chimeric antibody Fab 1E9, light chain

SCOPe Domain Sequences for d3o2vl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2vl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3o2vl2:

Click to download the PDB-style file with coordinates for d3o2vl2.
(The format of our PDB-style files is described here.)

Timeline for d3o2vl2: