PDB entry 3o2v

View 3o2v on RCSB PDB site
Description: Crystal structure of 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe, an engineered Diels-Alderase Fab with modified specificity and catalytic activity
Class: immune system
Keywords: IgG antibody Fab, IMMUNE SYSTEM
Deposited on 2010-07-22, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Chimeric antibody Fab 1E9, heavy chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O2V (0-End)
  • Chain 'L':
    Compound: Chimeric antibody Fab 1E9, light chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O2V (0-End)
    Domains in SCOPe 2.07: d3o2vl1, d3o2vl2
  • Heterogens: TRS, FLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3o2vL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthffptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o2vL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthffptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge