SCOPe 2.08: Domain d3o2dl2: 3o2d L:107-210

Lineage for d3o2dl2 (3o2d L:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3o2dl2: 3o2d L:107-210 [214127]
   Other proteins in same PDB: d3o2da1, d3o2da2, d3o2dh1, d3o2dh2, d3o2dl1
   automated match to d1rhha2

Details for d3o2dl2

PDB Entry: 3o2d, 2.19 Å

PDB Description: Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody

PDB Compounds: (L:) ibalizumab light chain

SCOPe Domain Sequences for d3o2dl2:

Sequence; same for both SEQRES and ATOM records:

>d3o2dl2 b.1.1.2 (L:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3o2dl2:

• d3o2dl2 first appeared in SCOPe 2.03
  
• d3o2dl2 appears in SCOPe 2.07