Lineage for d3o2da2 (3o2d A:98-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753476Protein CD4 C2-set domains [49149] (2 species)
  7. 2753477Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
  8. 2753483Domain d3o2da2: 3o2d A:98-178 [233060]
    Other proteins in same PDB: d3o2da1, d3o2dh1, d3o2dh2, d3o2dl1, d3o2dl2
    automated match to d1cdya2

Details for d3o2da2

PDB Entry: 3o2d (more details), 2.19 Å

PDB Description: Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3o2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2da2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d3o2da2:

Click to download the PDB-style file with coordinates for d3o2da2.
(The format of our PDB-style files is described here.)

Timeline for d3o2da2: