Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab of human IgM RF 2A2 [49101] (2 PDB entries) |
Domain d1deed2: 1dee D:1622-1723 [21411] Other proteins in same PDB: d1deea1, d1deeb1, d1deec1, d1deed1, d1deee1, d1deef1, d1deeg_, d1deeh_ |
PDB Entry: 1dee (more details), 2.7 Å
SCOP Domain Sequences for d1deed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deed2 b.1.1.2 (D:1622-1723) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2} gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl
Timeline for d1deed2: