Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [225947] (1 PDB entry) |
Domain d3o04a2: 3o04 A:252-413 [214097] automated match to d2alma2 |
PDB Entry: 3o04 (more details), 1.85 Å
SCOPe Domain Sequences for d3o04a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o04a2 c.95.1.0 (A:252-413) automated matches {Listeria monocytogenes [TaxId: 169963]} kiyaeivgygatgdayhitapapngegaaramkmaiddagltpdkvdyinahgtstpynd eyetqaiktvfgehakklaisstksmtghtlgasggieaifalltirdniiaptihlknq devcdldyvpneareanvnvvisnsfgfgghnatlvfkried
Timeline for d3o04a2: