SCOPe 2.07: Domain d3nz8l1: 3nz8 L:1-107

Lineage for d3nz8l1 (3nz8 L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3nz8l1: 3nz8 L:1-107 [214091]
   Other proteins in same PDB: d3nz8b2, d3nz8l2
   automated match to d1t66c1
   complexed with gol

Details for d3nz8l1

PDB Entry: 3nz8, 2.7 Å

PDB Description: crystal structure of the hiv-2 neutralizing fab fragment 7c8

PDB Compounds: (L:) Mouse anti V3 antibody 7C8 Fab, light chain

SCOPe Domain Sequences for d3nz8l1:

Sequence; same for both SEQRES and ATOM records:

>d3nz8l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqtivhsngytyldwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleik

Timeline for d3nz8l1:

• d3nz8l1 first appeared in SCOPe 2.03
  
• d3nz8l1 appears in SCOPe 2.06
  
• d3nz8l1 appears in the current release, SCOPe 2.08