Lineage for d3nivb1 (3niv B:1-81)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602980Species Legionella pneumophila [TaxId:272624] [196919] (2 PDB entries)
  8. 1602985Domain d3nivb1: 3niv B:1-81 [213986]
    Other proteins in same PDB: d3niva2, d3nivb2, d3nivc2, d3nivd2
    automated match to d1e6ba2

Details for d3nivb1

PDB Entry: 3niv (more details), 2.3 Å

PDB Description: the crystal structure of glutathione s-transferase from legionella pneumophila
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3nivb1:

Sequence, based on SEQRES records: (download)

>d3nivb1 c.47.1.0 (B:1-81) automated matches {Legionella pneumophila [TaxId: 272624]}
lilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpsldin
gqilsqsmaiidyleeihpem

Sequence, based on observed residues (ATOM records): (download)

>d3nivb1 c.47.1.0 (B:1-81) automated matches {Legionella pneumophila [TaxId: 272624]}
lilydyfrstacyrvrialnlkkiayekievvpsldingqilsqsmaiidyleeihpem

SCOPe Domain Coordinates for d3nivb1:

Click to download the PDB-style file with coordinates for d3nivb1.
(The format of our PDB-style files is described here.)

Timeline for d3nivb1: