Lineage for d3nhza_ (3nhz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856026Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries)
  8. 2856031Domain d3nhza_: 3nhz A: [213979]
    automated match to d2iyna_
    complexed with mg

Details for d3nhza_

PDB Entry: 3nhz (more details), 2.5 Å

PDB Description: Structure of N-terminal Domain of MtrA
PDB Compounds: (A:) Two component system transcriptional regulator mtrA

SCOPe Domain Sequences for d3nhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nhza_ c.23.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn
gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl

SCOPe Domain Coordinates for d3nhza_:

Click to download the PDB-style file with coordinates for d3nhza_.
(The format of our PDB-style files is described here.)

Timeline for d3nhza_: