PDB entry 3nhz

View 3nhz on RCSB PDB site
Description: Structure of N-terminal Domain of MtrA
Class: DNA binding protein
Keywords: Phosphoprotein, Transcription, Transcription regulation, Two-component regulatory system, DNA BINDING PROTEIN
Deposited on 2010-06-14, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two component system transcriptional regulator mtrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mtra, TBMG_03294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhza_
  • Chain 'B':
    Compound: Two component system transcriptional regulator mtrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mtra, TBMG_03294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhzb_
  • Chain 'C':
    Compound: Two component system transcriptional regulator mtrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mtra, TBMG_03294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhzc_
  • Chain 'D':
    Compound: Two component system transcriptional regulator mtrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mtra, TBMG_03294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhzd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nhzA (A:)
    mdtmrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlp
    gmngidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    rrndd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhzA (A:)
    mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn
    gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nhzB (B:)
    mdtmrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlp
    gmngidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    rrndd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhzB (B:)
    rqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmng
    idvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nhzC (C:)
    mdtmrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlp
    gmngidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    rrndd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhzC (C:)
    mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn
    gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nhzD (D:)
    mdtmrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlp
    gmngidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarl
    rrndd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhzD (D:)
    mrqrilvvdddaslaemltivlrgegfdtavigdgtqaltavrelrpdlvlldlmlpgmn
    gidvcrvlradsgvpivmltaktdtvdvvlglesgaddyimkpfkpkelvarvrarlr