Lineage for d3nevd_ (3nev D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444855Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)
  8. 2444867Domain d3nevd_: 3nev D: [213912]
    automated match to d3eb2a_
    complexed with edo, rsh

Details for d3nevd_

PDB Entry: 3nev (more details), 2.19 Å

PDB Description: Crystal structure of YagE, a prophage protein from E. coli K12 in complex with KDGal
PDB Compounds: (D:) Uncharacterized protein yagE

SCOPe Domain Sequences for d3nevd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nevd_ c.1.10.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

SCOPe Domain Coordinates for d3nevd_:

Click to download the PDB-style file with coordinates for d3nevd_.
(The format of our PDB-style files is described here.)

Timeline for d3nevd_: