Lineage for d3nc0f_ (3nc0 F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125639Domain d3nc0f_: 3nc0 F: [213876]
    automated match to d3ea5a_
    complexed with gol, gtp, iph, mg, peg

Details for d3nc0f_

PDB Entry: 3nc0 (more details), 2.9 Å

PDB Description: crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal ii)
PDB Compounds: (F:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3nc0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nc0f_ c.37.1.8 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp

SCOPe Domain Coordinates for d3nc0f_:

Click to download the PDB-style file with coordinates for d3nc0f_.
(The format of our PDB-style files is described here.)

Timeline for d3nc0f_: