Lineage for d3na8d_ (3na8 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098773Species Pseudomonas aeruginosa [TaxId:287] [226142] (2 PDB entries)
  8. 2098781Domain d3na8d_: 3na8 D: [213839]
    automated match to d2wnqa_
    complexed with mg, mlt

Details for d3na8d_

PDB Entry: 3na8 (more details), 1.85 Å

PDB Description: Crystal Structure of a putative dihydrodipicolinate synthetase from Pseudomonas aeruginosa
PDB Compounds: (D:) Putative dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3na8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3na8d_ c.1.10.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdevv
dftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhyr
avgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllgeg
rvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlpl
ldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr

SCOPe Domain Coordinates for d3na8d_:

Click to download the PDB-style file with coordinates for d3na8d_.
(The format of our PDB-style files is described here.)

Timeline for d3na8d_: