SCOPe 2.06: Domain d3na8d_: 3na8 D:

Lineage for d3na8d_ (3na8 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [226142] (2 PDB entries)

8. Domain d3na8d_: 3na8 D: [213839]
   automated match to d2wnqa_
   complexed with mg, mlt

Details for d3na8d_

PDB Entry: 3na8, 1.85 Å

PDB Description: Crystal Structure of a putative dihydrodipicolinate synthetase from Pseudomonas aeruginosa

PDB Compounds: (D:) Putative dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3na8d_:

Sequence; same for both SEQRES and ATOM records:

>d3na8d_ c.1.10.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdevv
dftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhyr
avgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllgeg
rvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlpl
ldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr

Timeline for d3na8d_:

• d3na8d_ first appeared in SCOPe 2.03
  
• d3na8d_ appears in SCOPe 2.05
  
• d3na8d_ appears in SCOPe 2.07
  
• d3na8d_ appears in the current release, SCOPe 2.08