Lineage for d3n8kk_ (3n8k K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466085Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2466086Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2466200Protein automated matches [190071] (5 species)
    not a true protein
  7. 2466269Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2466331Domain d3n8kk_: 3n8k K: [213803]
    Other proteins in same PDB: d3n8km2
    automated match to d3n8nd_
    complexed with cl, d1x

Details for d3n8kk_

PDB Entry: 3n8k (more details), 2.25 Å

PDB Description: Type II dehydroquinase from Mycobacterium tuberculosis complexed with citrazinic acid
PDB Compounds: (K:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n8kk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8kk_ c.23.13.1 (K:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d3n8kk_:

Click to download the PDB-style file with coordinates for d3n8kk_.
(The format of our PDB-style files is described here.)

Timeline for d3n8kk_: