SCOPe 2.05: Domain d3mybb_: 3myb B:

Lineage for d3mybb_ (3myb B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [196398] (4 PDB entries)

8. Domain d3mybb_: 3myb B: [213651]
   automated match to d3r9tb_
   complexed with gol

Details for d3mybb_

PDB Entry: 3myb, 1.55 Å

PDB Description: crystal structure of enoyl-coa hydratase mycobacterium smegmatis

PDB Compounds: (B:) enoyl-coa hydratase

SCOPe Domain Sequences for d3mybb_:

Sequence; same for both SEQRES and ATOM records:

>d3mybb_ c.14.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
eplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkaf
caghdlkemraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdl
avatrdarfavsginvglfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrv
vapkalddeieamvskivakpraavamgkalfyrqietdiesayadagttmacnmmdpsa
legvsaflekrrpewht

Timeline for d3mybb_:

• d3mybb_ first appeared in SCOPe 2.03
  
• d3mybb_ appears in SCOPe 2.04
  
• d3mybb_ appears in SCOPe 2.06
  
• d3mybb_ appears in the current release, SCOPe 2.08