Lineage for d3mybb_ (3myb B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354733Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1354734Protein automated matches [190246] (42 species)
    not a true protein
  7. 1354999Species Mycobacterium smegmatis [TaxId:246196] [196398] (3 PDB entries)
  8. 1355001Domain d3mybb_: 3myb B: [213651]
    automated match to d3r9tb_
    complexed with gol

Details for d3mybb_

PDB Entry: 3myb (more details), 1.55 Å

PDB Description: crystal structure of enoyl-coa hydratase mycobacterium smegmatis
PDB Compounds: (B:) enoyl-coa hydratase

SCOPe Domain Sequences for d3mybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mybb_ c.14.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
eplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkaf
caghdlkemraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdl
avatrdarfavsginvglfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrv
vapkalddeieamvskivakpraavamgkalfyrqietdiesayadagttmacnmmdpsa
legvsaflekrrpewht

SCOPe Domain Coordinates for d3mybb_:

Click to download the PDB-style file with coordinates for d3mybb_.
(The format of our PDB-style files is described here.)

Timeline for d3mybb_: