SCOPe 2.07: Domain d3mxua1: 3mxu A:1-121

Lineage for d3mxua1 (3mxu A:1-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [225903] (1 PDB entry)

8. Domain d3mxua1: 3mxu A:1-121 [213620]
   Other proteins in same PDB: d3mxua2
   automated match to d1onla_
   complexed with cit, edo, so4

Details for d3mxua1

PDB Entry: 3mxu, 1.8 Å

PDB Description: Crystal structure of glycine cleavage system protein H from Bartonella henselae

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3mxua1:

Sequence; same for both SEQRES and ATOM records:

>d3mxua1 b.84.1.0 (A:1-121) automated matches {Bartonella henselae [TaxId: 38323]}
msktyftqdhewlsvegqvvtvgitdyaqeqlgdlvfidlpqngtklskgdaaavvesvk
aasdvyapldgevveinaalaespelvnqkaetegwlwkmtvqdetqlerlldeaaykel
i

Timeline for d3mxua1:

• d3mxua1 first appeared in SCOPe 2.03, called d3mxua_
  
• d3mxua1 appears in SCOPe 2.06
  
• d3mxua1 appears in the current release, SCOPe 2.08