Lineage for d3mxua1 (3mxu A:1-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426865Species Bartonella henselae [TaxId:38323] [225903] (1 PDB entry)
  8. 2426866Domain d3mxua1: 3mxu A:1-121 [213620]
    Other proteins in same PDB: d3mxua2
    automated match to d1onla_
    complexed with cit, edo, so4

Details for d3mxua1

PDB Entry: 3mxu (more details), 1.8 Å

PDB Description: Crystal structure of glycine cleavage system protein H from Bartonella henselae
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3mxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxua1 b.84.1.0 (A:1-121) automated matches {Bartonella henselae [TaxId: 38323]}
msktyftqdhewlsvegqvvtvgitdyaqeqlgdlvfidlpqngtklskgdaaavvesvk
aasdvyapldgevveinaalaespelvnqkaetegwlwkmtvqdetqlerlldeaaykel
i

SCOPe Domain Coordinates for d3mxua1:

Click to download the PDB-style file with coordinates for d3mxua1.
(The format of our PDB-style files is described here.)

Timeline for d3mxua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mxua2