SCOPe 2.06: Domain d3moea1: 3moe A:1-259

Lineage for d3moea1 (3moe A:1-259)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (40 PDB entries)

8. Domain d3moea1: 3moe A:1-259 [213501]
   Other proteins in same PDB: d3moea2, d3moea3
   automated match to d1khba2
   complexed with 1pe, edo, gtp, mn, na, spv; mutant

Details for d3moea1

PDB Entry: 3moe, 1.25 Å

PDB Description: the structure of rat cytosolic pepck mutant a467g in complex with beta-sulfopyruvate and gtp

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d3moea1:

Sequence; same for both SEQRES and ATOM records:

>d3moea1 c.109.1.1 (A:1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahm
qeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmsee
dfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsv
lealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsl
lgkkcfalriasrlakeeg

Timeline for d3moea1:

• d3moea1 first appeared in SCOPe 2.03
  
• d3moea1 appears in SCOPe 2.05
  
• d3moea1 appears in SCOPe 2.07
  
• d3moea1 appears in the current release, SCOPe 2.08