SCOPe 2.07: Domain d3mlja2: 3mlj A:199-355

Lineage for d3mlja2 (3mlj A:199-355)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)

6. Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries)

8. Domain d3mlja2: 3mlj A:199-355 [213327]
   automated match to d1sdwa2
   complexed with act, cmo, cu, gol, ni

Details for d3mlja2

PDB Entry: 3mlj, 2.15 Å

PDB Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound carbon monooxide (CO)

PDB Compounds: (A:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d3mlja2:

Sequence; same for both SEQRES and ATOM records:

>d3mlja2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipip

Timeline for d3mlja2:

• d3mlja2 first appeared in SCOPe 2.03
  
• d3mlja2 appears in SCOPe 2.06
  
• d3mlja2 appears in the current release, SCOPe 2.08