Lineage for d3mlja1 (3mlj A:46-198)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1563154Superfamily b.121.1: PHM/PNGase F [49742] (2 families) (S)
    members of this superfamily bind peptide substrates
    duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits
  5. 1563168Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)
  6. 1563169Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)
  7. 1563170Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (17 PDB entries)
  8. 1563183Domain d3mlja1: 3mlj A:46-198 [213326]
    automated match to d1sdwa1
    complexed with act, cmo, cu, gol, ni

Details for d3mlja1

PDB Entry: 3mlj (more details), 2.15 Å

PDB Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound carbon monooxide (CO)
PDB Compounds: (A:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d3mlja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlja1 b.121.1.2 (A:46-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdt
vhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsk
yfvlqvhygdisafrdnhkdcsgvsvhltrvpq

SCOPe Domain Coordinates for d3mlja1:

Click to download the PDB-style file with coordinates for d3mlja1.
(The format of our PDB-style files is described here.)

Timeline for d3mlja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mlja2