Lineage for d3mkpb1 (3mkp B:36-126)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702965Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 1702966Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 1702967Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 1702997Protein automated matches [191160] (2 species)
    not a true protein
  7. 1702998Species Human (Homo sapiens) [TaxId:9606] [225941] (1 PDB entry)
  8. 1703000Domain d3mkpb1: 3mkp B:36-126 [213302]
    Other proteins in same PDB: d3mkpa2, d3mkpb2, d3mkpc2, d3mkpd2
    automated match to d1bhta1
    complexed with epe, sgn, so4; mutant

Details for d3mkpb1

PDB Entry: 3mkp (more details), 2.81 Å

PDB Description: crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d3mkpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkpb1 g.10.1.1 (B:36-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

SCOPe Domain Coordinates for d3mkpb1:

Click to download the PDB-style file with coordinates for d3mkpb1.
(The format of our PDB-style files is described here.)

Timeline for d3mkpb1: