Lineage for d3mg2b1 (3mg2 B:4-173)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507668Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 1507669Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (1 family) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 1507670Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 1507675Protein automated matches [227037] (1 species)
    not a true protein
  7. 1507676Species Synechocystis sp. [TaxId:1148] [225877] (3 PDB entries)
  8. 1507682Domain d3mg2b1: 3mg2 B:4-173 [213243]
    Other proteins in same PDB: d3mg2a2, d3mg2b2
    automated match to d1m98a1
    complexed with ech; mutant

Details for d3mg2b1

PDB Entry: 3mg2 (more details), 2.65 Å

PDB Description: crystal structure of the orange carotenoid protein y44s mutant from cyanobacteria synechocystis sp. pcc 6803
PDB Compounds: (B:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg2b1:

Sequence, based on SEQRES records: (download)

>d3mg2b1 a.175.1.1 (B:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaslemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d3mg2b1 a.175.1.1 (B:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaslemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvlrnavvdmgfria

SCOPe Domain Coordinates for d3mg2b1:

Click to download the PDB-style file with coordinates for d3mg2b1.
(The format of our PDB-style files is described here.)

Timeline for d3mg2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mg2b2