| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
| Protein automated matches [226901] (10 species) not a true protein |
| Species Methylobacillus flagellatus [TaxId:265072] [225898] (1 PDB entry) |
| Domain d3mcqa1: 3mcq A:7-135 [213204] Other proteins in same PDB: d3mcqa2 automated match to d3c9ua1 complexed with 1pe, na, peg, pg4, pge |
PDB Entry: 3mcq (more details), 1.91 Å
SCOPe Domain Sequences for d3mcqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcqa1 d.79.4.0 (A:7-135) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
liqryfrrahpsavlgvgddaaliqpspgmelavsadmlvanthfypnidpwligwksla
vnisdmaamgaqprwatltialpeadedwiskfaagffacaaqfdialiggdttrgplti
svqimgetp
Timeline for d3mcqa1: