Lineage for d3mcqa1 (3mcq A:7-135)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566869Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2566954Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2566955Protein automated matches [226901] (10 species)
    not a true protein
  7. 2566982Species Methylobacillus flagellatus [TaxId:265072] [225898] (1 PDB entry)
  8. 2566983Domain d3mcqa1: 3mcq A:7-135 [213204]
    Other proteins in same PDB: d3mcqa2
    automated match to d3c9ua1
    complexed with 1pe, na, peg, pg4, pge

Details for d3mcqa1

PDB Entry: 3mcq (more details), 1.91 Å

PDB Description: crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d3mcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcqa1 d.79.4.0 (A:7-135) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
liqryfrrahpsavlgvgddaaliqpspgmelavsadmlvanthfypnidpwligwksla
vnisdmaamgaqprwatltialpeadedwiskfaagffacaaqfdialiggdttrgplti
svqimgetp

SCOPe Domain Coordinates for d3mcqa1:

Click to download the PDB-style file with coordinates for d3mcqa1.
(The format of our PDB-style files is described here.)

Timeline for d3mcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mcqa2