SCOPe 2.08: Domain d3mb5a1: 3mb5 A:1-253

Lineage for d3mb5a1 (3mb5 A:1-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225890] (1 PDB entry)

8. Domain d3mb5a1: 3mb5 A:1-253 [213175]
   Other proteins in same PDB: d3mb5a2
   automated match to d2yvla_
   protein/RNA complex; complexed with act, edo, sam, so4

Details for d3mb5a1

PDB Entry: 3mb5, 1.6 Å

PDB Description: Crystal structure of P. abyssi tRNA m1A58 methyltransferase in complex with S-adenosyl-L-methionine

PDB Compounds: (A:) SAM-dependent methyltransferase

SCOPe Domain Sequences for d3mb5a1:

Sequence; same for both SEQRES and ATOM records:

>d3mb5a1 c.66.1.0 (A:1-253) automated matches {Pyrococcus abyssi [TaxId: 29292]}
miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilr
privdyldkmkrgpqivhpkdaalivayagispgdfiveagvgsgaltlflanivgpegr
vvsyeiredfaklawenikwagfddrvtiklkdiyegieeenvdhvildlpqpervveha
akalkpggffvaytpcsnqvmrlheklrefkdyfmkprtinvlvfdqevkkecmrprtta
lvhtgyitfarri

Timeline for d3mb5a1:

• d3mb5a1 first appeared in SCOPe 2.03, called d3mb5a_
  
• d3mb5a1 appears in SCOPe 2.07