SCOPe 2.07: Domain d3maka1: 3mak A:2-85

Lineage for d3maka1 (3mak A:2-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (17 PDB entries)

8. Domain d3maka1: 3mak A:2-85 [213171]
   Other proteins in same PDB: d3maka2
   automated match to d1jlva2
   complexed with gsh

Details for d3maka1

PDB Entry: 3mak, 1.8 Å

PDB Description: crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione

PDB Compounds: (A:) Glutathione S-transferase 1-1

SCOPe Domain Sequences for d3maka1:

Sequence; same for both SEQRES and ATOM records:

>d3maka1 c.47.1.0 (A:2-85) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vdfyylpgsspcrsvimtakavgvelnkkllnlqagehlkpeflkinpqhtiptlvdngf
alwesraiqvylvekygktdslyp

Timeline for d3maka1:

• d3maka1 first appeared in SCOPe 2.03
  
• d3maka1 appears in SCOPe 2.06
  
• d3maka1 appears in the current release, SCOPe 2.08