SCOPe 2.04: Domain d3maea_: 3mae A:

Lineage for d3maea_ (3mae A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.0: automated matches [191456] (1 protein)
   not a true family

6. Protein automated matches [190703] (5 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:265669] [225867] (1 PDB entry)

8. Domain d3maea_: 3mae A: [213168]
   automated match to d1c4tc_
   complexed with cl, gol, po4

Details for d3maea_

PDB Entry: 3mae, 2.5 Å

PDB Description: crystal structure of probable dihydrolipoamide acetyltransferase from listeria monocytogenes 4b f2365

PDB Compounds: (A:) 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase

SCOPe Domain Sequences for d3maea_:

Sequence; same for both SEQRES and ATOM records:

>d3maea_ c.43.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 265669]}
aagdkeipingvrkaiakhmsvskqeiphawmmvevdatglvryrnavkdsfkkeegysl
tyfaffikavaqalkefpqlnstwagdkiiehaninisiaiaagdllyvpviknadeksi
kgiareiselagkarngklsqadmeggtftvnstgsfgsvqsmgiinhpqaailqvesiv
krpviiddmiavrdmvnlclsidhrildgllagkflqaikanvekiskentaly

Timeline for d3maea_:

• d3maea_ first appeared in SCOPe 2.03
  
• d3maea_ appears in SCOPe 2.05
  
• d3maea_ appears in the current release, SCOPe 2.08