Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
Protein automated matches [190703] (5 species) not a true protein |
Species Listeria monocytogenes [TaxId:265669] [225867] (1 PDB entry) |
Domain d3maea_: 3mae A: [213168] automated match to d1c4tc_ complexed with cl, gol, po4 |
PDB Entry: 3mae (more details), 2.5 Å
SCOPe Domain Sequences for d3maea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3maea_ c.43.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 265669]} aagdkeipingvrkaiakhmsvskqeiphawmmvevdatglvryrnavkdsfkkeegysl tyfaffikavaqalkefpqlnstwagdkiiehaninisiaiaagdllyvpviknadeksi kgiareiselagkarngklsqadmeggtftvnstgsfgsvqsmgiinhpqaailqvesiv krpviiddmiavrdmvnlclsidhrildgllagkflqaikanvekiskentaly
Timeline for d3maea_: